Application Thank you, for being a person, who would also like to set a personal marker on the world map. So everyone can see, “I Care Community"(I2C) principles”. For each individual there is a short procedure. Important is that you must get invited by someone else who does already have a map marker. To accept your request, you need an invitation code form that someone. With this IV Code you will receive 50% discount on your first-year fee. The invitation code is to strengthen the chain of trust in each other. The thought behind this, is that you stay in touch with the person who invite you and you also stay in touch with those persons who you will invite. The chain of trust is broken when you will act contrary to QCP principles. Every person that you invite, include yourself will know that act contrary is to QCP principles. This is not without consequences. Application * (Select)A - Activated I2C markerP - Passive I2C No marker Country * (Select)NL-528AF-004AX-248AL-008DZ-012AS-016AD-020AO-024AI-660AQ-010AG-028AR-032AM-051AW-533AU-036AT-040AZ-031BS-044BH-048BD-050BB-052BY-112BE-056BZ-084BJ-204BM-060BT-064BO-068BQ-535BA-070BW-072BV-074BR-076IO-086BN-096BG-100BF-854BI-108KH-116CM-120CA-124CV-132KY-136CF-140TD-148CI-830CL-152CN-156CX-162CC-166CO-170KM-174CG-178CD-180CK-184CR-188CI-384HR-191CU-192CW-531CY-196CZ-203DK-208DJ-262DM-212DO-214EC-218EG-818SV-222GQ-226ER-232EE-233ET-231FO-234FK-238FJ-242FI-246FR-250GF-254PF-258TF-260GA-266GM-270GE-268DE-276GH-288GI-292GB-826GR-300GL-304GD-308GP-312GU-316GT-320GG-826TIGN-324GW-624GY-328HT-332HM-334HN-340HK-344HU-348IS-352IN-356ID-360IR-364IQ-368IE-372IM-833IL-376IT-380JM-388JP-392JE-826TIJO-400KZ-398KE-404KI-296KP-408KR-410KW-414KG-417LA-418LV-428LB-422LS-426LR-430LY-434LI-438LT-440LU-442MO-446MK-807MG-450MW-454MY-458MV-462ML-466MT-470MH-584MQ-474MR-478MU-480YT-175MX-484FM-583MD-498MC-492MN-496ME-499MS-500MA-504MZ-508MM-104NA-516NR-520NP-524AN-530NC-540NZ-554NI-558NE-562NG-566NU-570NF-574MP-580NO-578OM-512PK-586PW-585PS-275PA-591PG-598PY-600PE-604PH-608PN-612PL-616PT-620PR-630QA-634RE-638RO-642RU-643RW-646BL-652SH-654KN-659LC-662MF-663PM-666VC-670WS-882SM-674ST-678SA-682SN-686RS-688SC-690SL-694SG-702SX-534SK-703SI-705SB-090SO-706ZA-710GS-239ES-724LK-144SD-736SR-740SJ-744SZ-748SE-752CH-756SY-760TW-158TJ-762TZ-834TH-764TL-626TG-768TK-772TO-776TT-780TN-788TR-792TM-795TC-796TV-798UG-800UA-804AE-784GB-826US-840UM-581UY-858UZ-860VU-548VA-336VE-862VN-704VG-092VI-850WF-876EH-732YE-887ZM-894ZW-716 Request date * Received an IV-Code * Yes No Invitation verification code is needed A. Personal Details Prefix * (Select)Mr.Mrs.X First Name(s) * Last Name * Called Name * Date of birth Nationality * Level of Education * (Select Education)MS (Middle School)HS (High School) NA (National Academy)NPC (National Police College)LEA (Law Enforcement Academy) MA (Military Academy)UD (University Degree)OE (Other Education) Personal identification code * Require 5-10 alphanumeric characters. Other Education level B .Contact Information E-mail Address * Region * City * Country * (Select)NLAFAXALDZASADAOAIAQAGARAMAWAUATAZBSBHBDBBBYBEBZBJBMBTBOBQBABWBVBRIOBNBGBFBIKHCMCACVKYCFTDCLCNCXCCCOKMCGCDCKCRCIHRCUCWCYCZDKDJDMDOECEGSVGQEREEETFOFKFJFIFRGFPFTFGAGMGEDEGHGIGBGRGLGDGPGUGTGGGNGWGYHTHMHNHKHUISINIDIRIQIEIMILITJMJPJEJOKZKEKIKPKRKWKGLALVLBLSLRLYLILTLUMOMKMGMWMYMVMLMTMHMQMRMUYTMXFMMDMCMNMEMSMAMZMMNANRNPANNCNZNINENGNUNFMPNOOMPKPWPSPAPGPYPEPHPNPLPTPRQARERORURWBLSHKNLCMFPMVCWSSMSTSASNRSSCSLSGSXSKSISBSOZAGSSSESLKSDSRSJSZSECHSYTWTJTZTHTLTGTKTOTTTNTRTMTCTVUGUAAEGBUSUMUYUZVUVAVEVNVGVIWFEHYEZMZW Second e-mail address Optional Phone Number Optional for future verification Street + No Optional Zip Code Optional C. Professional background Active duty * (Select)Member of StaffVolunteerRetired On daily bases Level inside * (Select working level)EmployeeExpertTeam leaderManagerDirectorVP Working area * Select areaLocalRegionalNationalInternational Name of duty * Function Domain Choice * (Select)Justice CareHealth CareEducation CareScience CareWorld CareGovernmental CarePrivate Firm CareFinance Care D. Verification part Received VI-Code * Verification Invitation Code VI Code VI Code correct then it will appear here. Email Inviter * Email Confirm your role at I2C Active Passive ID generator I2C.ID * IC.ID Personal IV-number * Following number for IV-person * 1, 2, 3, 4 ...55, ... 99, 100 Your message, why a marker statement * short Initiative I2C 1 Star 2 Stars 3 Stars 4 Stars 5 Stars E. Final Annual Contribution € For 1 or 3 Year(s) Select1 Year3 Years Total Fee € E-Signature * signature keyboard Clear Yes * I hereby declare that the information I have provided is truthful, accurate and I agree to the terms and condition of IC4You2 Terms of us click here to read If you are human, leave this field blank.